top of page
LE REVE2.jpg

PN polynucleotide is the structure of DNA thethat directly replaces > repair > target cell regeneration > DNA Renewal.

Stem cell Growth Factors ️are stem cells. Stimulates the division of skin cells Replacing damaged cells >>Rejuvenating, repairing the skin, making the skin look younger.
 

LE REVE2.jpg

1. The Concentration of HA which is a beaded Hyaluronic Acid by MDM Tech.® ( Micro Bead Monophasic , Divinyl sulfone multi-crosslink , Multiple Degree Amphiphilic Purification) is 0.6%.

MDM-Tech-HA-768x192.jpg

2. Maximum Concentration of PDRN which is without cloudy suspension and salmon smell for cellular proliferation DNA raw materials(0.3%).

PDRN-Tech-768x192.jpg

Laboratory Result of Le Reve HS +

Le-Reve-Fibroblast.jpg
Le-Reve-Keratinocyte-1.jpg
Fibroblast-Number-by-Aging.jpg
Le-Reve-Keratinocyte.jpg
Le-Reve-Collagen-test-2.jpg
Le-Reve-Collagen-test-1.jpg

SKIN BENEFITS

Le REVE HS Plus contains 1,400k Da Non-Crosslinked HA 0.5% (High Molecular Weight, Maximum concentration as Skin Booster), which prevents skin aging by containing HA of sufficient quality to ensure the best water resistance and skin affinity among the skin boosters developed so far. You can keep your skin moisturizing and elastic.

• Stimulate natural skin regeneration and healing at cellular level
• Visible Skin Brightening & Glow
• Improved Skin Elasticity & Hydration
• Unclog Pores and removal of dead cells
• Stimulation of Collagen and more even skin tone
• Thickening Skin & Decreasing Fine Wrinkles
• Decreasing Pimples and Acne

The PN in Le REVE HS Plus is an ingredient that maximizes the efficacy because

1) Source(Salmon Sperm) based on the know-how of filler technology development and specialized technology.
2) Maximum concentration without cloudy and smell 0.3%
3) It is composed 4 kinds of Nucleotide ( A C T G ) which can be source to DNA synthesis. 

DNA source  from Salmon Sperm DNA “PN(Polynucleotide)

PDRN-Effect-768x469.png

The PN in Le REVE HS Plus is an ingredient that maximizes the efficacy because

The PN in Le REVE HS Plus is an ingredient that maximizes the efficacy because

1) Source(Salmon Sperm) based on the know-how of filler technology development and specialized technology.
2) Maximum concentration without cloudy and smell 0.3%
3) It is composed 4 kinds of Nucleotide ( A C T G ) which can be source to DNA synthesis.

2) Maximum concentration without cloudy and smell 0.3%
3) It is composed 4 kinds of Nucleotide ( A C T G ) which can be source to DNA synthesis. 

Stemcell GROWTH FACTORS 

The peptides contained in Le REVE HS Plus contain only 100% of the stem cell growth factor components existing in the human body, and any synthetic peptides are not added.
The contents are 10 to 100 times higher concentration than skin boosters containing existing stem cell growth factors.
EGF: 1 ppm,  a-FGF: 0.1 ppm, b-FGF: 1 ppm, IGF-1: 0.1 ppm,PDGF-a: 1 ppm, PDGF-b1: 0.5 ppm, VEGF: 0.5 ppm, TGF-b1: 0.5ppm, Interleukin 10: 0.1ppm

EGF(Epidermal Growth Factor, rh(sh)-Oligopeptide-1) 

Structure
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR),  with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).

Main 2 Functions 
1. EGF stimulates the cell proliferation(Differentiation, maturation and survival of a variety of Fibroblasts, Epithelial cells, Mesenchymal  Cells, Neurons).
2. EGF enhances cytoprotection( Injury cells by PI3K-Akt Activation ).
3. Others –

Mechanism 
1. EGF binds with EGFR(Tyrosine kinase receptor)
2. This Binding initiates Phosphorylation-Mediated Mechanism
3. A variety of Biochemical Changes within the cell – a rise in intracellular calcium levels, increased glycolysis  and  protein synthesis, and increases in the expression of certain genes including the gene for EGFR – that ultimately lead to DNA synthesis and cell proliferation.

Usage
1. Diabetic foot ulcers.
2. Bone regeneration-Osteogenic differentiation of dental pulp stem cells (DPSCs)-10ppm.
3. Modify synthetic scaffolds for manufacturing of bioengineered grafts.
4. Cosmetics for Skin Rejuvenation.

reference :Epidermal growth factor in clinical practice, https://pubmed.ncbi.nlm.nih.gov/19912390/

EGF(Epidermal Growth Factor, rh(sh)-Oligopeptide-1) 

Structure
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR),  with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).

Main 2 Functions 
1. EGF stimulates the cell proliferation(Differentiation, maturation and survival of a variety of Fibroblasts, Epithelial cells, Mesenchymal  Cells, Neurons).
2. EGF enhances cytoprotection( Injury cells by PI3K-Akt Activation ).
3. Others –

Mechanism 
1. EGF binds with EGFR(Tyrosine kinase receptor)
2. This Binding initiates Phosphorylation-Mediated Mechanism
3. A variety of Biochemical Changes within the cell – a rise in intracellular calcium levels, increased glycolysis  and  protein synthesis, and increases in the expression of certain genes including the gene for EGFR – that ultimately lead to DNA synthesis and cell proliferation.

Usage
1. Diabetic foot ulcers.
2. Bone regeneration-Osteogenic differentiation of dental pulp stem cells (DPSCs)-10ppm.
3. Modify synthetic scaffolds for manufacturing of bioengineered grafts.
4. Cosmetics for Skin Rejuvenation.

reference :Epidermal growth factor in clinical practice, https://pubmed.ncbi.nlm.nih.gov/19912390/

IGF( IGF-1, rh(sh)-Oligopeptide-2, )

Structure
There is 2 IGF-1, IGF-2. IGF-1
IGF-1 is consisted  by  70 aminoacids single chain three disulfied bonds Peptides , 7,649Da

Main 2 Functions 
1. IGF-1 is promotion of cell proliferation and the inhibition of cell death (apoptosis). an involvement in regulating neural development including neurogenesis, myelination, synaptogenesis, and dendritic branching and neuroprotection after neuronal damage.
2. DNA synthesis
3. Others – 

Mechanism 
1. IGF-1  is secreted by the liver as a result of stimulation by growth hormone (GH).
2.  IGFs bind with IGF Binding Proteins (IGFBP1 to IGFBP7)
3. Binding with IGF-1 and IGFBP(3) activates Intracellular Signaling Pathway

Usage
1. Augment Growth Hormone efficacy.
2. Tumor Marker 

reference : Insulin-Like Growth Factor-1 Physiology  https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5488279/

FGF (Fibroblast Growth Factor-a,b.~.  rh(sh)-Polypeptides-1,2,~23 )

Structure
FGF is a Familial growth Factors(In humans, 23 members of the FGF family).
example :
FGF-a( FGF-1, rh(sh)-Polypeptides-1) is  17-18 kDa. non-glycosylated polypeptides.
FGF-b( FGF-2, rh(sh)-Polypeptides-11) is 17.1 kDa, β trefoil structure polypeptides.

Main 2 Fuctions
1. FGFs are multifunctional proteins with a wide variety of effects; they are most commonly mitogens but also have regulatory, morphological, and endocrine effects.- developmental processes include mesoderm induction, anterior-posterior patterning,[8] limb development, neural induction and neural development,[16] and in mature tissues/systems angiogenesis, keratinocyte organization, and wound healing processes
2.FGF1 and FGF2 stimulate angiogenesis and the proliferation of fibroblasts that give rise to granulation tissue ( FGF1 and FGF2 are more potent angiogenic factors than vascular endothelial growth factor (VEGF) or platelet-derived growth factor (PDGF)).
3. Others –

Mechanism 
1. FGF binds with Heparan sulfate(Heparan Sulfate ProteoGlycan,HSPG) and fibroblast growth factor receptors (FGFR).
2. These unique features, as well as the role of the intracellular pool of FGF1 and FGF2, are far from being fully understood. 

1-s2.0-S1359610120300435-ga1_lrg.jpg

Usage
1. Dysregulation of the FGF signalling system underlies a range of diseases associated with the increased FGF expression. Inhibitors of FGF signalling have shown clinical efficacy.
2. Some FGF ligands (particularly FGF2) have been demonstrated to enhance tissue repair (e.g. skin burns, grafts, and ulcers) in a range of clinical settings.

reference : The FGF family: biology, pathophysiology and therapy – PubMed (nih.gov) https://pubmed.ncbi.nlm.nih.gov/19247306/  

PDGF(Platelet-derived growth factor- a,b,  rh(sh)-Polypeptide-8,59)

Structure
PDGFs are five isoforms, 32~35 kDa.  disulfide-linked Dimeric Glycoprotein(2 subunit)
PDGF-AA (PDGFA), -BB (PDGFB), -CC (PDGFC), and -DD (PDGFD), and -AB (a PDGFA and PDGFB heterodimer). 

Main 2 Fuctions 
1. PDGFs are mitogenic during early developmental stages, driving the proliferation of undifferentiated  mesenchyme  and some progenitor populations.
2. During later maturation stages, PDGF signalling has been implicated in tissue remodelling and cellular differentiation, and in inductive events involved in patterning and morphogenesis.
3. Others 

Mechanism 
1. PDGFs binds with PDGFRs(two tyrosine kinase receptor, a &b type) and HSPG
2. “switched on” by auto-phosphorylation
3. gene expression and protein synthesis

Usage
1. chronic ulcers and in orthopedic surgery and periodontics as an alternative to bone autograft to stimulate bone regeneration and repair.
2. Many Organogenesis

reference :  Role of platelet-derived growth factors in physiology and medicine – https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2732412/#!po=0.604839

VEGF((Vascular Endothelial Growth factor, rh(sh)-polypeptides-9)

Structure
VEGF Family is five , 32~35 kDa.  disulfide-linked Dimeric Glycoprotein(2 subunit)
VEGF-a, VEGF-b, VEGF-c, VEGF-d, PGF

Main 2 Fuctions 
1. VEGFs are Angiogenesis by ↑ Migration of endothelial cells, ↑ mitosis of endothelial cells, ↑ Matrix metalloproteinase activity, ↑ αvβ3 activity, ↑ Migration and proliferation of Astrocytes ,creation of blood vessel lumen, and creates fenestrations and  Chemotactic for macrophages and granulocytes, Vasodilation (indirectly by NO release), Lymphangiogenesis.
2. PGF(Placenta growth Factor) is also family of VEGFS which is strong Anigiogenesis during some damages.
3. Others –

Mechanism 
1. VEGFs binds with VEGFRs(3 types)
2. transphosphorylation
3. gene expression and protein synthesis

Usage
1. acute and sub-acute stages of CNS injury by endogenous revascularization
2.  Biomarker

reference :The vascular endothelial growth factor (VEGF) family: angiogenic factors in health and disease https://www.ncbi.nlm.nih.gov/pmc/articles/PMC551528/

TGF((Transforming Growth factor, TGF-b1 rh(sh)-polypeptides-22)

Structure
TGF a, TGF b(1,2,3)
TGF-b1 is 25 kDa.  390 Aminoacids, polypeptides -22

 

Main 2 Fuctions 
1. TGF b is multifunctional set of peptides that controls proliferation, differentiation, and other functions in many cell types.
2.  TGF b is an  important role in controlling the immune system.

Mechanism (TGF beta signaling pathway)
1. TGF b1 binds TGFβ receptors(Type 1, Type 2) are single pass serine/threonine kinase receptors.
2. SMAD Phosphorylation -> CoSMAD binding -> Transcryition
3. gene expression and protein synthesis

Usage
1. wounds with impaired healing, mucositis, fractures, ischemia-reperfusion injuries, and autoimmune disease.
2. In diseases such as keloids, glomerulonephritis and pulmonary fibrosis, excessive expression of TGF-β has been implicated as being responsible for accumulation of detrimental scar tissue. 

reference : https://en.wikipedia.org/wiki/Transforming_growth_factor_beta
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC1069016/

AMINOACIDS

Collagen Type I, which accounts for most of dermal collagen, consists of a total of 29 amino acids, of which mainly Glysine, Hydroxyproline, Proline, Alanine, are helix-linked in a ratio of 60% or more to form fibrous cells.

Le REVE HS Plus contains 200% to 300% higher content of the L-type three amino acids (Glysine, Hydroxyproline, Proline), which are the main ingredients of Collagen Type I, than other skin boosters.
Le REVE HS Plus does not contain 1) Alanine, which causes tissue irritation, 2)Tyrosine and Phenylalanine, which are raw material of Melanin Pigment.

collagen-structure-768x429.jpg

Le REVE HS Plus contains vitamins that improve the basic metabolism of the skin in an optimal concentration, and in particular, NIACINAMIDE, Vit B3, which enhances whitening, antioxidant, and collagen synthesis, is contained in the maximum concentration(200ppm)) that does not cause problems even if it enters the skin directly.

Skin Mechanism of Niacin-amide


1, Niacin-amide collects melanin pigment synthesized in melanocytes and blocks the transfer of “Melanosome”, a non-pocket, to keratinocytes by 35%~68%.
2. Niacin-amide synthesizes collagen by promoting “m-RNA transcription” that synthesizes collagen in the dermal layer.
3. Niacin-amide promotes the proliferation of keratinocytes by activating “mKGF”. It is accompanied by effects such as reducing pores, suppressing sebum excretion, and relieving acne.
 

GLUTATHIONE

Le REVE HS Plus contains the highest concentration(400ppm/ml) of glutathione that humans cannot detect with the eyes and nose of browning and sulfur odors. 

1. In the process of synthesizing melanin in melanocytes, it synthesizes “Pheomelanin”, which is a pink (middle of red and yellow) melanin pigment instead of black melanin pigment.
2. It is difficult to pass through the cell membrane, but once it passes, it becomes the center of strong antioxidant by “continuously recycling hydrogen”.
3. Combining with lead, which is the main cause of cosmetic poisoning, is discharged and can increase the intensity of tumor treatment by protecting normal cells during chemotherapy.

Q & A

How can we keep the 2years’ “best before date” expiration period without ” Preservative” and “Alcohol”?

1. All raw components of Le Reve are used by Pharmaceutical Grade Ingredients.
2. Le Reve use 200 nano filtration Filter( Filtration by Sartorius Filter, PALL Biotech Filter,  which can absolutely remove Bacteria)
3.Le Reve is filled in Positive Air Pressure and ISO Class 5 Clean Room.
4.Le Reve is housed in Double Lid Pharmaceutical Glass Vials.

Can Le Reve  use facial lifting?

When operator can do Tension Column Technique (0.5ml) on face,Le Reve can use enough Viscoelasticity(CP 60+) and Collagen Synthesis capacity.

Why does all ingredients of Le Reve consists of only ingredients that exist in the human body?

1. Since Skin Booster is a cosmetic procedure material that penetrates into the dermis layer, Cosmetics Developer MD.Kim formulates to consists only of ingredients present in the human body to minimizing side effects and maximizing effects.
2. Artificial synthetic ingredients were restricted  so that the user of Le Reve could mix and use additionally necessary ingredients (botox, tranexamic acid, atherocollagen, Placenta extract,etc.).

What kinds of MesoTheray Technique?

1.  Nappage Technique  : Amount 0.02ml~0.05ml,Distance 5mm Depth :Epidermis Papillary Dermis Junction
2. Tension Column technique :  Amount 0.5ml, Place: Tension Column Points,  Depth :Deep Dermis Junction
3. Wrinkle Papule Technique : Amount 0.05ml~0.1ml, Place: Wrinkle Line Depth :Papillo-Recticular Dermis Junction
4. Oridinary Technique :  Amount 0.02ml~0.05ml,Distance 10mm Depth :Papillary Dermis

What is the big difference between Le Reve and other skin boosters?

1. High Molecular and Maximum Concentration of HA which wiill be disappear the embossing within 72hrs as Moisturizing Component (140M Da HA,0.5%).
2. Maximum Concentration of PN which is without cloudy suspension and salmon smell for cellular proliferation DNA raw materials(0.3%).
3. Very High Concentration of Growth Factors compare to existing Skin Booster as Stemcell Activator(about 10 to 100 times).
4. Maximum Concentration of Glutathione without discoloration and odor as Antioxidant and Brightening agent .
5. Le Reve is not included the ” Surfactants”, “Artificial Solvent” ,” Preservative”, “Fragrance”, “Colorant”,” Silicone” and even “Synthetic Peptides”.
6.Le REVE HS Plus does not contain 1) Alanine, which causes tissue irritation, 2)Tyrosine and Phenylalanine, which are raw material of Melanin Pigment.

Is Le Reve painful during procedure?

Almost all of customers did not complain of pain during procedure after 9.6% Lidocain Cream apply for 25min and add 10min, total 35min.
If  we want more anesthesia, Dr can add Peripheral nerve block ( Supra-Orbital NB, Supra-Trochlear NB,  Zygomatic NB(Infra-Orbital NB), MandibularNB.)Supra-Orbital NB, Supra-Trochlear NB

Supra-orbital-n-Supra-Trochlear-N-768x300.jpg
INFRA-ORBITAL-NERVE-n-VARIATION-768x402.jpg

How long does the embossing last?

Usually Embossing disappear within 72hrs. when PDRN added case embossing will be longer.

 

How can customers know the effects?

A Customer can start to feel the improved moisturizing, brightness and elasticity about 3 days after first session, and these will be continue more than 4 wks.

How long does the effect last?

 1 session : more than 8wks
3sessions : more than 6months
Full sessions: more than 1year

ALL BRANDED PRODUCTS ARE GUARANTED 100% AUTHENTIC.
We accept also bulk orders, for more question and details just contact us.
Globe: 09669306672

bottom of page